PDB entry 3hbn

View 3hbn on RCSB PDB site
Description: crystal structure pseg-udp complex from campylobacter jejuni
Deposited on 2009-05-04, released 2009-05-26
The last revision was dated 2021-10-13, with a file datestamp of 2021-10-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-sugar hydrolase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: PseG (Cj1312)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P8U5 (0-273)
      • engineered mutation (154)
      • expression tag (274-281)
  • Heterogens: UDP, GOL, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3hbnA (A:)
mkvlfrsdsssqigfghikrdlvlakqysdvsfaclplegslideipypvyelssesiye
linlikeekfelliidhygisvddeklikletgvkilsfddeikphhcdillnvnayaka
sdyeglvpfkcevrcgfsyalireefyqeakenrkkkydfficmggtdiknlslqiasel
pktkiisiatsssnpnlkklqkfaklhnnirlfidheniaklmnesnkliisasslvnea
lllkanfkaicyvknqestatwlakkgyeveykylehhhhhh