PDB entry 3hbe

View 3hbe on RCSB PDB site
Description: Class IV chitinase structure from Picea abies at 1.55A
Class: hydrolase
Keywords: endochitinase, chitinase, class IV, family 19, conformational changes, Chitin-binding, Glycosidase, Hydrolase
Deposited on 2009-05-04, released 2009-08-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.164
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Class IV chitinase Chia4-Pa2
    Species: Picea abies [TaxId:3329]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hbex_
  • Heterogens: MXE, ACT, FOR, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hbeX (X:)
    svggiisqsffnglaggaasscegkgfytynafiaaanaysgfgttgsndvkkrelaaff
    anvmhetgglcyineknppinycqssstwpctsgksyhgrgplqlswnynygaagksigf
    dglnnpekvgqdstisfktavwfwmknsnchsaitsgqgfggtikainsmecnggnsgev
    ssrvnyykkicsqlgvdpganvsc