PDB entry 3haw

View 3haw on RCSB PDB site
Description: Crystal structure of [L-Ala51/51']HIV-1 protease with reduced isostere MVT-101 inhibitor
Deposited on 2009-05-02, released 2011-04-27
The last revision was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.187
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: [L-Ala51/51']HIV-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3HAW (0-98)
  • Chain 'B':
    Compound: [L-Ala51/51']HIV-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3HAW (0-98)
  • Heterogens: 2NC, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3hawA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgcwkpkliggiagfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3hawB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgcwkpkliggiagfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf