PDB entry 3hal

View 3hal on RCSB PDB site
Description: Crystal structure of Rabbit acidic fibroblast growth factor
Class: hormone
Keywords: beta-trefoil, HORMONE
Deposited on 2009-05-01, released 2009-12-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor 1 isoform 1
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: FGF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3hala_
  • Chain 'B':
    Compound: Fibroblast growth factor 1 isoform 1
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: FGF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3halb_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3halA (A:)
    hhhhhhfnlpagnyklpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpseeclflerleenhyntytskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3halA (A:)
    nyklpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyla
    mdtdgllygsqtpseeclflerleenhyntytskkhaeknwfvglkkngsckrgprthyg
    qkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3halB (B:)
    hhhhhhfnlpagnyklpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpseeclflerleenhyntytskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3halB (B:)
    nyklpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqyla
    mdtdgllygsqtpseeclflerleenhyntytskkhaeknwfvglkkngsckrgprthyg
    qkailflplpv