PDB entry 3ha9

View 3ha9 on RCSB PDB site
Description: the 1.7a crystal structure of a thioredoxin-like protein from aeropyrum pernix
Deposited on 2009-05-01, released 2009-05-19
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized Thioredoxin-like protein
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: APE2568, APE_2568.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y8R5 (3-End)
      • expression tag (1-2)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ha9A (A:)
    snapraaghseevlereasfslttidgevislnnvggdvvilwfmaawcpscvymadlld
    rltekyreisviaidfwtaealkalglnkpgypppdtpemfrkfianygdpswimvmddg
    slvekfnvrsidyivimdkssnvlyagttpslgelesviksvqgg
    

    Sequence, based on observed residues (ATOM records):
    >3ha9A (A:)
    napraaghseevlereasfslttidgevislnnvggdvvilwfmaawcpscvymadlldr
    ltekyreisviaidfwtaealkalglnkpgypppdtpemfrkfianygdpswimvmddgs
    lvekfnvrsidyivimdkssnvlyagttpslgelesviksv