PDB entry 3ha6

View 3ha6 on RCSB PDB site
Description: Crystal structure of aurora A in complex with TPX2 and compound 10
Class: transferase
Keywords: AURORA A, SERINE/THREONINE-PROTEIN KINASE, COFACTOR, TPX2, INHIBITOR, PHOSPHORYLATION, ATP-BINDING, CELL CYCLE, NUCLEOTIDE-BINDING, PHOSPHOPROTEIN, TRANSFERASE, NUCLEUS, Kinase
Deposited on 2009-05-01, released 2009-08-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.225
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AIK, ARK1, AURA, AURKA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.04: d3ha6a_
  • Chain 'B':
    Compound: Targeting protein for Xklp2
    Species: Homo sapiens [TaxId:9606]
    Gene: C20orf1, C20orf2, DIL2, HCA519, TPX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULW0 (1-End)
      • expression tag (0)
  • Heterogens: 2JZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ha6A (A:)
    gkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ha6A (A:)
    gkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitanss
    

  • Chain 'B':
    No sequence available.