PDB entry 3h9r

View 3h9r on RCSB PDB site
Description: Crystal structure of the kinase domain of type I activin receptor (ACVR1) in complex with FKBP12 and dorsomorphin
Class: isomerase/protein kinase
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, ATP-binding, Disease mutation, Glycoprotein, Kinase, Magnesium, Manganese, Membrane, Metal-binding, Nucleotide-binding, Phosphoprotein, Receptor, Serine/threonine-protein kinase, Transferase, Transmembrane, Isomerase, Rotamase, ISOMERASE-PROTEIN KINASE COMPLEX
Deposited on 2009-04-30, released 2009-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.19
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activin receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVR1, ACVRLK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3h9ra_
  • Chain 'B':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP1A
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP1, FKBP12, FKBP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3h9rb_
  • Heterogens: TAK, SO4, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h9rA (A:)
    smttnvgdstladlldhsctsgsgsglpflvqrtvarqitllecvgkgrygevwrgswqg
    envavkifssrdekswfretelyntvmlrhenilgfiasdmtsrhsstqlwlithyhemg
    slydylqlttldtvsclrivlsiasglahlhieifgtqgkpaiahrdlksknilvkkngq
    cciadlglavmhsqstnqldvgnnprvgtkrymapevldetiqvdcfdsykrvdiwafgl
    vlwevarrmvsngivedykppfydvvpndpsfedmrkvvcvdqqrpnipnrwfsdptlts
    laklmkecwyqnpsarltalrikktltkid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h9rA (A:)
    ttnvgdstladlldhsctsgsgsglpflvqrtvarqitllecvgkgrygevwrgswqgen
    vavkifssrdekswfretelyntvmlrhenilgfiasdmtsstqlwlithyhemgslydy
    lqlttldtvsclrivlsiasglahlhieifgtqgkpaiahrdlksknilvkkngqcciad
    lglavmhrvgtkrymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedy
    kppfydvvpndpsfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarlt
    alrikktltkid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h9rB (B:)
    smgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirg
    weegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h9rB (B:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle