PDB entry 3h9n

View 3h9n on RCSB PDB site
Description: Crystal structure of the ribosome maturation factor rimm (hi0203) from h.influenzae. northeast structural genomics consortium target IR66.
Class: ribosomal protein
Keywords: Crystal Structure, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, IR66, rimM, Chaperone, Cytoplasm, Ribosome biogenesis, RIBOSOMAL PROTEIN
Deposited on 2009-04-30, released 2009-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome maturation factor rimM
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0203, rimM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44568 (0-170)
      • expression tag (171-176)
    Domains in SCOPe 2.08: d3h9na1, d3h9na2, d3h9na3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3h9nA (A:)
    hievvgklgstygirgwlriyssteqaesifdyqpwflkikgewqsielenwryhnheii
    vklkgvddreaaqilanveigvdlsvfpeleegdyywhdligctvvnlegytmgtvtemm
    etgsndvlvvkantkdafgkqerlipflyeqvvkrvdlttktievdwdagflehhhh