PDB entry 3h93

View 3h93 on RCSB PDB site
Description: Crystal Structure of Pseudomonas aeruginosa DsbA
Class: transcription regulator
Keywords: Disulfide bond, Redox-active center, TRANSCRIPTION REGULATOR
Deposited on 2009-04-29, released 2009-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thiol:disulfide interchange protein dsbA
  Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
  Gene: dsbA, PA5489
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C2B2 (3-191)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d3h93a1, d3h93a2
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3h93A (A:)
  snaddytagkeyvelsspvpvsqpgkievvelfwygcphcyafeptivpwseklpadvhf
  vrlpalfggiwnvhgqmfltlesmgvehdvhnavfeaihkehkklatpeemadflagkgv
  dkekflstynsfaikgqmekakklamayqvtgvptmvvngkyrfdigsaggpeetlklad
  yliekeraaakk