PDB entry 3h8y

View 3h8y on RCSB PDB site
Description: Crystal structure of carboxysome small shell protein CsoS1C from Halothiobacillus neapolitanus
Class: structural protein
Keywords: bacterial microcompartment domain, STRUCTURAL PROTEIN
Deposited on 2009-04-29, released 2009-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major carboxysome shell protein 1C
    Species: Halothiobacillus neapolitanus [TaxId:927]
    Gene: csoS1C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3h8ya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3h8yA (A:)
maavtgialgmietrglvpaieaadamtkaaevrlvgrqfvgggyvtvlvrgetgavnaa
vragadacervgdglvaahiiarvhsevenilpkapea

    Sequence, based on observed residues (ATOM records): (download) 
    >3h8yA (A:)
vtgialgmietrglvpaieaadamtkaaevrlvgrqfvgggyvtvlvrgetgavnaavra
gadacervgdglvaahiiarvhsevenilpkapea