PDB entry 3h8r

View 3h8r on RCSB PDB site
Description: structure determination of dna methylation lesions n1-mea and n3-mec in duplex dna using a cross-linked host-guest system
Deposited on 2009-04-29, released 2010-03-31
The last revision was dated 2021-10-13, with a file datestamp of 2021-10-08.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABH2, AlkB human homolog 2(ABH2), ALKBH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NS38 (3-208)
      • expression tag (0-2)
      • engineered mutation (14)
      • engineered mutation (112)
      • engineered mutation (122)
      • engineered mutation (139)
  • Chain 'B':
    Compound: 5'-d(*cp*tp*gp*tp*ap*tp*(2yr)p*ap*tp*(6ma)p*gp*cp*g)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'C':
    Compound: 5'-d(*tp*cp*gp*cp*tp*ap*tp*ap*ap*tp*ap*cp*a)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: GOL, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3h8rA (A:)
gshswrhiraegldssytvlfgkaeadeifqelekeveyftgalarvqvfgkwhsvprkq
atygdagltytfsgltlspkpwipvlerirdhvsgvtgqtfnfvlinrykdgsdhigehr
ddcrelapgspiasvsfgasrdfvfrhkdsrgkspsrrvavvrlplahgsllmmnhptnt
hwyhslpvrkkvlaprvnltfrkilltkk

    Sequence, based on observed residues (ATOM records):
    >3h8rA (A:)
hswrhiraegldssytvlfgkaeadeifqelekeveyftgalarvqvfgkwhsvprkqat
ygdagltytfsgltlspkpwipvlerirdhvsgvtgqtfnfvlinrykdgsdhigehrdd
crelapgspiasvsfgasrdfvfrhkdsrgkspsrrvavvrlplahgsllmmnhptnthw
yhslpvrkkvlaprvnltfrkill

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.