PDB entry 3h8n

View 3h8n on RCSB PDB site
Description: Crystal Structure Analysis of KIR2DS4
Class: immune system
Keywords: ligand-binding domains, Cell membrane, Disulfide bond, Glycoprotein, Immunoglobulin domain, Membrane, Polymorphism, Receptor, Transmembrane, IMMUNE SYSTEM
Deposited on 2009-04-29, released 2009-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-10, with a file datestamp of 2009-11-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Killer cell immunoglobulin-like receptor 2DS4
    Species: Homo sapiens [TaxId:9606]
    Gene: CD158I, KIR2DS4, KIR2DS4*0010101, KKA3, NKAT8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3h8na1, d3h8na2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3h8nA (A:)
    rkpsflalpghlvkseetvilqcwsdvmfehfllhregkfnntlhligehhdgvskanfs
    igpmmpvlagtyrcygsvphspyqlsapsdpldmviiglyekpslsaqpgptvqagenvt
    lscssrssydmyhlsregeaherrlpavrsingtfqadfplgpathggtyrcfgsfrdap
    yewsnssdpllvsvt