PDB entry 3h8k

View 3h8k on RCSB PDB site
Description: Crystal structure of Ube2g2 complxed with the G2BR domain of gp78 at 1.8-A resolution
Class: ligase
Keywords: alpha beta, all alpha, Ligase, Ubl conjugation pathway, Endoplasmic reticulum, Membrane, Metal-binding, Phosphoprotein, Receptor, Transmembrane, Zinc-finger
Deposited on 2009-04-29, released 2009-07-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 G2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2G2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3h8ka_
  • Chain 'B':
    Compound: Autocrine motility factor receptor, isoform 2
    Species: Homo sapiens [TaxId:9606]
    Gene: AMFR, RNF45
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKV5 (0-27)
      • engineered (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3h8kA (A:)
    agtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsfp
    ldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsvekill
    svvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl
    

  • Chain 'B':
    No sequence available.