PDB entry 3h8c

View 3h8c on RCSB PDB site
Description: A combined crystallographic and molecular dynamics study of cathepsin-L retro-binding inhibitors (compound 14)
Class: hydrolase
Keywords: Cysteine Proteases, Cathepsin L, Disulfide bond, Glycoprotein, Hydrolase, Lysosome, Protease, Thiol protease, Zymogen
Deposited on 2009-04-29, released 2009-10-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.237
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Cathepsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3h8ca_
  • Chain 'B':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Cathepsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3h8cb_
  • Heterogens: NSZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h8cA (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h8cA (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h8cB (B:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h8cB (B:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv