PDB entry 3h8b

View 3h8b on RCSB PDB site
Description: A combined crystallographic and molecular dynamics study of cathepsin-L retro-binding inhibitors(compound 9)
Class: hydrolase
Keywords: cysteine proteases, Cathepsin L, Disulfide bond, Glycoprotein, Hydrolase, Lysosome, Protease, Thiol protease, Zymogen
Deposited on 2009-04-29, released 2009-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.216
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Cathepsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h8ba_
  • Chain 'B':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Cathepsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h8bb_
  • Chain 'C':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Cathepsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h8bc_
  • Chain 'D':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Cathepsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h8bd_
  • Chain 'E':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Cathepsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h8be_
  • Chain 'F':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Cathepsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h8bf_
  • Heterogens: NSY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h8bA (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h8bA (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h8bB (B:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h8bB (B:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h8bC (C:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h8bC (C:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3h8bD (D:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h8bD (D:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3h8bE (E:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h8bE (E:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3h8bF (F:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h8bF (F:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv