PDB entry 3h89

View 3h89 on RCSB PDB site
Description: A combined crystallographic and molecular dynamics study of cathepsin-L retro-binding inhibitors(compound 4)
Class: hydrolase
Keywords: Cysteine proteases, Cathepsin L, Disulfide bond, Glycoprotein, Hydrolase, Lysosome, Protease, Thiol protease, Zymogen
Deposited on 2009-04-29, released 2009-10-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Catehpsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3h89a_
  • Chain 'B':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Catehpsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3h89b_
  • Chain 'C':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Catehpsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3h89c_
  • Chain 'D':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Catehpsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3h89d_
  • Chain 'E':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Catehpsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3h89e_
  • Chain 'F':
    Compound: Cathepsin L1
    Species: Homo sapiens [TaxId:9606]
    Gene: Catehpsin L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3h89f_
  • Heterogens: NSX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h89A (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h89A (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h89B (B:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h89B (B:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h89C (C:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h89C (C:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3h89D (D:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h89D (D:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3h89E (E:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h89E (E:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3h89F (F:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h89F (F:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv