PDB entry 3h81

View 3h81 on RCSB PDB site
Description: Crystal structure of enoyl-CoA hydratase from Mycobacterium tuberculosis
Class: lyase
Keywords: NIAID, deCODE, infectious disease, MPCS, Fatty acid metabolism, Lipid metabolism, Lyase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2009-04-28, released 2009-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-CoA hydratase echA8
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA8, Rv1070c, MT1100, MTV017.23c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h81a_
  • Chain 'B':
    Compound: enoyl-CoA hydratase echA8
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA8, Rv1070c, MT1100, MTV017.23c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h81b_
  • Chain 'C':
    Compound: enoyl-CoA hydratase echA8
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: echA8, Rv1070c, MT1100, MTV017.23c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h81c_
  • Heterogens: GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h81A (A:)
    mahhhhhhmgtleaqtqgpgsmtyetilverdqrvgiitlnrpqalnalnsqvmnevtsa
    ateldddpdigaiiitgsakafaagadikemadltfadaftadffatwgklaavrtptia
    avagyalgggcelammcdvliaadtakfgqpeiklgvlpgmggsqrltraigkakamdli
    ltgrtmdaaeaersglvsrvvpaddlltearatattisqmsasaarmakeavnrafessl
    segllyerrlfhsafatedqsegmaafiekrapqfthr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h81A (A:)
    tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf
    aagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvlia
    adtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvp
    addlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqse
    gmaafiekrapqfthr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h81B (B:)
    mahhhhhhmgtleaqtqgpgsmtyetilverdqrvgiitlnrpqalnalnsqvmnevtsa
    ateldddpdigaiiitgsakafaagadikemadltfadaftadffatwgklaavrtptia
    avagyalgggcelammcdvliaadtakfgqpeiklgvlpgmggsqrltraigkakamdli
    ltgrtmdaaeaersglvsrvvpaddlltearatattisqmsasaarmakeavnrafessl
    segllyerrlfhsafatedqsegmaafiekrapqfthr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h81B (B:)
    tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf
    aagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvlia
    adtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvp
    addlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqse
    gmaafiekrapqfth
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h81C (C:)
    mahhhhhhmgtleaqtqgpgsmtyetilverdqrvgiitlnrpqalnalnsqvmnevtsa
    ateldddpdigaiiitgsakafaagadikemadltfadaftadffatwgklaavrtptia
    avagyalgggcelammcdvliaadtakfgqpeiklgvlpgmggsqrltraigkakamdli
    ltgrtmdaaeaersglvsrvvpaddlltearatattisqmsasaarmakeavnrafessl
    segllyerrlfhsafatedqsegmaafiekrapqfthr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h81C (C:)
    tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf
    aagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvlia
    adtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvp
    addlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqse
    gmaafiekrapqfthr