PDB entry 3h7z

View 3h7z on RCSB PDB site
Description: a transition from strong right-handed to canonical left-handed supercoiling in a conserved coiled coil segment of trimeric autotransporter adhesins - the m1 mutant structure
Deposited on 2009-04-28, released 2010-03-31
The last revision was dated 2021-10-13, with a file datestamp of 2021-10-08.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.235
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adhesin yadA
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: yadA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C2W0 (0-59)
      • engineered mutation (46-47)
      • engineered mutation (49)
      • expression tag (60)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3h7zA (A:)
    htlktansytdvtvsnstkkairesnqytdhkfhqldnrldkldtrllkllassaalnsl
    l