PDB entry 3h7q

View 3h7q on RCSB PDB site
Description: Crystal structure of the holo-[Acyl-Carrier-Protein] Synthase (ACPS) from Mycobacterium tuberculosis
Class: transferase
Keywords: Homo-trimer, 9-stand pseudo beta barrel protein, Cytoplasm, Fatty acid biosynthesis, Lipid synthesis, Magnesium, Metal-binding, Transferase
Deposited on 2009-04-28, released 2010-04-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.207
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Holo-[acyl-carrier-protein] synthase
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Gene: Rv2523c
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A4W8 (2-131)
    • expression tag (0-1)
  Domains in SCOPe 2.04: d3h7qa_
• Heterogens: BCN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3h7qA (A:)
  gamgivgvgidlvsipdfaeqvdqpgtvfaetftpgerrdasdksssaarhlaarwaake
  avikawsgsrfaqrpvlpedihrdievvtdmwgrprvrltgaiaeyladvtihvsltheg
  dtaaavaileap
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3h7qA (A:)
  gamgivgvgidlvsipdfaeqvdqpgtvfaetftpgerrdasdksssaarhlaarwaake
  avikawsgsrfaihrdievvtrprvrltgaiaeyladvtihvslthegdtaaavaileap