PDB entry 3h7i

View 3h7i on RCSB PDB site
Description: Structure of the metal-free D132N T4 RNase H
Class: hydrolase
Keywords: BPT4 RNase H, 5'-3' exonuclease, HYDROLASE, Endonuclease, Nuclease
Deposited on 2009-04-27, released 2010-05-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.181
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease H
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 33.2, das, rnh
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13319 (Start-304)
      • engineered (131)
    Domains in SCOPe 2.06: d3h7ia1, d3h7ia2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h7iA (A:)
    mdlemmldedykegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkakt
    lgytkivlcidnaksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaymp
    yivmdidkyeandhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki
    ksgsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqak
    vllteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltn
    sinef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h7iA (A:)
    emmldedykegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgy
    tkivlcidnaksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaympyiv
    mdidkyeandhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvkiksg
    saeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvll
    teseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsin
    ef