PDB entry 3h7f

View 3h7f on RCSB PDB site
Description: Crystal structure of serine hydroxymethyltransferase from Mycobacterium tuberculosis
Class: transferase
Keywords: MYCOBACTERIUM TUBERCULOSIS, serine hydroxymethyltransferase, One-carbon metabolism, Pyridoxal phosphate, Transferase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2009-04-24, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine hydroxymethyltransferase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glyA1, glyA, Rv1093, MT1125, MTV017.46
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53441 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.07: d3h7fa1, d3h7fa2
  • Chain 'B':
    Compound: Serine hydroxymethyltransferase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glyA1, glyA, Rv1093, MT1125, MTV017.46
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53441 (21-446)
      • expression tag (19-20)
    Domains in SCOPe 2.07: d3h7fb1, d3h7fb2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h7fA (A:)
    mahhhhhhmgtleaqtqgpgsmsaplaevdpdiaellakelgrqrdtlemiasenfvpra
    vlqaqgsvltnkyaeglpgrryyggcehvdvvenlardrakalfgaefanvqphsgaqan
    aavlhalmspgerllgldlangghlthgmrlnfsgklyengfygvdpathlidmdavrat
    alefrpkviiagwsayprvldfaafrsiadevgakllvdmahfaglvaaglhpspvphad
    vvsttvhktlgggrsglivgkqqyakainsavfpgqqggplmhviagkavalkiaatpef
    adrqrrtlsgariiadrlmapdvakagvsvvsggtdvhlvlvdlrdspldgqaaedllhe
    vgitvnrnavpndprppmvtsglrigtpalatrgfgdteftevadiiatalatgssvdvs
    alkdratrlarafplydgleewslvgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h7fA (A:)
    gsmsaplaevdpdiaellakelgrqrdtlemiasenfvpravlqaqgsvltnkyaeglpg
    rryyggcehvdvvenlardrakalfgaefanvqphsgaqanaavlhalmspgerllgldl
    angghlthgmrlnfsgklyengfygvdpathlidmdavratalefrpkviiagwsayprv
    ldfaafrsiadevgakllvdmahfaglvaaglhpspvphadvvsttvhktlgggrsgliv
    gkqqyakainsavfpgqqggplmhviagkavalkiaatpefadrqrrtlsgariiadrlm
    apdvakagvsvvsggtdvhlvlvdlrdspldgqaaedllhevgitvnrsglrigtpalat
    rgfgdteftevadiiatalatgssvdvsalkdratrlarafplydgleewslvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h7fB (B:)
    mahhhhhhmgtleaqtqgpgsmsaplaevdpdiaellakelgrqrdtlemiasenfvpra
    vlqaqgsvltnkyaeglpgrryyggcehvdvvenlardrakalfgaefanvqphsgaqan
    aavlhalmspgerllgldlangghlthgmrlnfsgklyengfygvdpathlidmdavrat
    alefrpkviiagwsayprvldfaafrsiadevgakllvdmahfaglvaaglhpspvphad
    vvsttvhktlgggrsglivgkqqyakainsavfpgqqggplmhviagkavalkiaatpef
    adrqrrtlsgariiadrlmapdvakagvsvvsggtdvhlvlvdlrdspldgqaaedllhe
    vgitvnrnavpndprppmvtsglrigtpalatrgfgdteftevadiiatalatgssvdvs
    alkdratrlarafplydgleewslvgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h7fB (B:)
    gsmsaplaevdpdiaellakelgrqrdtlemiasenfvpravlqaqgsvltnkyaeglpg
    rryyggcehvdvvenlardrakalfgaefanvqphsgaqanaavlhalmspgerllgldl
    angghlthgmrlnfsgklyengfygvdpathlidmdavratalefrpkviiagwsayprv
    ldfaafrsiadevgakllvdmahfaglvaaglhpspvphadvvsttvhktlgggrsgliv
    gkqqyakainsavfpgqqggplmhviagkavalkiaatpefadrqrrtlsgariiadrlm
    apdvakagvsvvsggtdvhlvlvdlrdspldgqaaedllhevgitvnrnavpndprppmv
    tsglrigtpalatrgfgdteftevadiiatalatgssvdvsalkdratrlarafplydgl
    eewslvgr