PDB entry 3h6n

View 3h6n on RCSB PDB site
Description: Crystal Structure of the ubiquitin-like domain of plexin D1
Class: signaling protein
Keywords: structural genomics consortium, SGC, MEMBRANE, transmembrane, receptor, Alternative splicing, Cell membrane, Glycoprotein, Polymorphism, SIGNALING PROTEIN
Deposited on 2009-04-23, released 2009-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plexin-D1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXND1, KIAA0620
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3h6na_
  • Heterogens: ARS, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3h6nA (A:)
gakprnlnvsfqgcgmdslsvramdtdtltqvkekileafcknvpysqwpraedvdlewf
asstqsyilrdlddtsvvedgrkklntlahykipegaslamslidkkdntlgrvkdldte
kyfhlvl

    Sequence, based on observed residues (ATOM records): (download) 
    >3h6nA (A:)
akprnlnvsfqgcgmdslsvramdtdtltqvkekileafcknvpysqwpraedvdlewfa
sstqsyilrdlddtsvvedgrkklntlahykipegaslamslid