PDB entry 3h5v

View 3h5v on RCSB PDB site
Description: Crystal structure of the GluR2-ATD
Class: transport protein
Keywords: Glutamate receptor, Ligand-gated ion channel, synapse, Cell junction, Cell membrane, Endoplasmic reticulum, Glycoprotein, Ion transport, Ionic channel, Lipoprotein, Membrane, Palmitate, Phosphoprotein, Postsynaptic cell membrane, Receptor, RNA editing, Transmembrane, Transport, TRANSPORT PROTEIN
Deposited on 2009-04-22, released 2009-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.19
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h5va_
  • Chain 'B':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h5vb_
  • Chain 'C':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h5vc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h5vA (A:)
    ieergvssnsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtna
    fcsqfsrgvyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgal
    lslieyyqwdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslf
    qdlelkkerrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggan
    vsgfqivdyddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrk
    qrieisrrgnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinim
    elktngprkigywsevdkmvvtltelpslelvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h5vA (A:)
    snsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsr
    gvyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyy
    qwdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkk
    errvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqiv
    dyddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisr
    rgnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngp
    rkigywsevdkmvvtl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h5vB (B:)
    ieergvssnsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtna
    fcsqfsrgvyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgal
    lslieyyqwdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslf
    qdlelkkerrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggan
    vsgfqivdyddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrk
    qrieisrrgnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinim
    elktngprkigywsevdkmvvtltelpslelvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h5vB (B:)
    snsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsr
    gvyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyy
    qwdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkk
    errvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqiv
    dyddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisr
    rgnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngp
    rkigywsevdkmvvtl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h5vC (C:)
    ieergvssnsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtna
    fcsqfsrgvyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgal
    lslieyyqwdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslf
    qdlelkkerrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggan
    vsgfqivdyddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrk
    qrieisrrgnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinim
    elktngprkigywsevdkmvvtltelpslelvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h5vC (C:)
    iqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrgvy
    aifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyqwd
    kfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkkerr
    vildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivdyd
    dslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrrgn
    agdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngprki
    gywsevdkmvvtl