PDB entry 3h58

View 3h58 on RCSB PDB site
Description: Myoglobin Cavity Mutant H64LV68N Met form
Class: oxygen storage, oxygen transport
Keywords: Myoglobin, active site hydration, ligand entry and exit, oxygen storage and transport, Heme, Iron, Metal-binding, Muscle protein, Oxygen transport, Transport, OXYGEN STORAGE
Deposited on 2009-04-21, released 2009-05-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered (64)
      • engineered (68)
      • engineered (122)
    Domains in SCOPe 2.01: d3h58a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3h58A (A:)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkklgvtnltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg