PDB entry 3h53

View 3h53 on RCSB PDB site
Description: Crystal Structure of human alpha-N-acetylgalactosaminidase
Class: hydrolase
Keywords: GLYCOPROTEIN, CARBOHYDRATE-BINDING PROTEIN, GLYCOSIDASE, LYSOSOMAL ENZYME, (BETA/ALPHA)8 BARREL, Disease mutation, Disulfide bond, Hydrolase, Lysosome
Deposited on 2009-04-21, released 2009-10-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.163
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-N-acetylgalactosaminidase
    Species: Homo sapiens [TaxId:9606]
    Gene: nagA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17050 (0-End)
      • engineered (183)
    Domains in SCOPe 2.03: d3h53a1, d3h53a2
  • Chain 'B':
    Compound: alpha-N-acetylgalactosaminidase
    Species: Homo sapiens [TaxId:9606]
    Gene: nagA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17050 (0-End)
      • engineered (183)
    Domains in SCOPe 2.03: d3h53b1, d3h53b2
  • Heterogens: GOL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h53A (A:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypiknlemsqqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h53A (A:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h53B (B:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypiknlemsqqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h53B (B:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypik