PDB entry 3h50

View 3h50 on RCSB PDB site
Description: crystal structure of a tetracenomycin polyketide synthesis protein (tcmj) from xanthomonas campestris pv. campestris at 1.60 a resolution
Deposited on 2009-04-21, released 2009-05-05
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracenomycin polyketide synthesis protein
    Species: Xanthomonas campestris pv. campestris [TaxId:340]
    Gene: NP_636471.1, tcmJ, XCC1096
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PBM3 (1-113)
      • leader sequence (0)
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3h50A (A:)
gmqyatlelnnafkvlfslrqvqaaemviapgdreggpdnrhrgadqwlfvvdgageaiv
dghtqalqagsliaiergqaheirntgdtplktvnfyhppaydaqgeplpageg