PDB entry 3h4y

View 3h4y on RCSB PDB site
Description: crystal structure of putative chemotaxis protein (yp_009526.1) from desulfovibrio vulgaris hildenborough at 1.55 a resolution
Deposited on 2009-04-21, released 2009-05-05
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative chemotaxis protein
    Species: Desulfovibrio vulgaris str. Hildenborough [TaxId:882]
    Gene: DVU_0302, YP_009526.1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CIT, MRD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3h4yA (A:)
gmsvngievakpfiaatvnvlstmagiqpqpgkpyvkknnvakgdvsavigitghkngsi
svtftkscaialvkgmlgddiqdilqdtkdavgevtnmisgqaraglaemgmvfqgstps
vimgdghtishvtkspimaipfltnhgeftvefcfe

    Sequence, based on observed residues (ATOM records):
    >3h4yA (A:)
svngievakpfiaatvnvlstmagiqpqpgkpyvkknnvakgdvsavigitghkngsisv
tftkscaialvkgmlgddiqdilqdtkdavgevtnmisgqaraglaemgmvfqgstpsvi
mgdghtishvtkspimaipfltnhgeftvefcfe