PDB entry 3h4t

View 3h4t on RCSB PDB site
Description: Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc
Class: transferase
Keywords: glycosyltransferase, vancomycin, teicoplanin, GtfA, orf1, natural products, antibiotic, TRANSFERASE
Deposited on 2009-04-20, released 2009-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycosyltransferase GtfA, Glycosyltransferase
    Species: Actinoplanes teichomyceticus [TaxId:1867]
    Gene: gtfA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96558 (Start-213)
      • see remark 999 (1)
      • see remark 999 (205)
    • Uniprot Q6ZZJ7 (214-End)
      • expression tag (390-397)
    Domains in SCOPe 2.08: d3h4ta1, d3h4ta2
  • Heterogens: PO4, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h4tA (A:)
    mgvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag
    arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr
    ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla
    adpvlsplrptdlgtvqtgawilpdqrplsaelegflragsppvyvgfgsgpapaeaarv
    aieavraqgrrvvlssgwaglgridegddclvvgevnhqvlfgrvaavvhhggagtttav
    tragapqvvvpqkadqpyyagrvadlgvgvahdgptptveslsaalataltpgiraraaa
    vagtirtdgttvaakllleaisrqrssvpaaklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4tA (A:)
    gvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravraga
    repgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyry
    tvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwlaa
    dpvlsplrptdlgtvqtgawilpdqrplsaelegflragsppvyvgfgsgpapaeaarva
    ieavraqgrrvvlssgwaglgridegddclvvgevnhqvlfgrvaavvhhggagtttavt
    ragapqvvvpqkadqpyyagrvadlgvgvahdgptptveslsaalataltpgiraraaav
    agtirtdgttvaakllleaisraklaaale