PDB entry 3h4j

View 3h4j on RCSB PDB site
Description: crystal structure of pombe AMPK KDAID fragment
Class: transferase
Keywords: AMPK, kinase, ATP-binding, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2009-04-20, released 2009-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SNF1-like protein kinase ssp2
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: ssp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74536 (Start-327)
      • expression tag (328-330)
    Domains in SCOPe 2.06: d3h4ja1, d3h4ja2
  • Chain 'B':
    Compound: SNF1-like protein kinase ssp2
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: ssp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O74536 (Start-327)
      • expression tag (328-332)
    Domains in SCOPe 2.06: d3h4jb1, d3h4jb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h4jA (A:)
    maiskrhigpyiiretlgegsfgkvklathyktqqkvalkfisrqllkksdmhmrverei
    sylkllrhphiiklydvittptdivmvieyaggelfdyivekkrmtedegrrffqqiica
    ieychrhkivhrdlkpenlllddnlnvkiadfglsnimtdgnflktscgspnyaapevin
    gklyagpevdvwscgivlyvmlvgrlpfddefipnlfkkvnscvyvmpdflspgaqslir
    rmivadpmqritiqeirrdpwfnvnlpdylrpmeevqgsyadsrivsklgeamgfsedyi
    vealrsdennevkeaynllhenqviqeklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4jA (A:)
    krhigpyiiretlgegsfgkvklathyktqqkvalkfisrqllkksdmhmrvereisylk
    llrhphiiklydvittptdivmvieyaggelfdyivekkrmtedegrrffqqiicaieyc
    hrhkivhrdlkpenlllddnlnvkiadfglsnimtdgnflktscgspnyaapevingkly
    agpevdvwscgivlyvmlvgrlpfddefiyvmpdflspgaqslirrmivadpmqritiqe
    irrdpwfnvnlpdylrpmeevqgsyadsrivsklgeamgfsedyivealrsdennevkea
    ynllhenqviqekleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h4jB (B:)
    maiskrhigpyiiretlgegsfgkvklathyktqqkvalkfisrqllkksdmhmrverei
    sylkllrhphiiklydvittptdivmvieyaggelfdyivekkrmtedegrrffqqiica
    ieychrhkivhrdlkpenlllddnlnvkiadfglsnimtdgnflktscgspnyaapevin
    gklyagpevdvwscgivlyvmlvgrlpfddefipnlfkkvnscvyvmpdflspgaqslir
    rmivadpmqritiqeirrdpwfnvnlpdylrpmeevqgsyadsrivsklgeamgfsedyi
    vealrsdennevkeaynllhenqviqeklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h4jB (B:)
    skrhigpyiiretlgegsfgkvklathyktqqkvalkfisrqllkksdmhmrvereisyl
    kllrhphiiklydvittptdivmvieyaggelfdyivekkrmtedegrrffqqiicaiey
    chrhkivhrdlkpenlllddnlnvkiadfglsnimtdgnflktscgspnyaapevingkl
    yagpevdvwscgivlyvmlvgrlpfddefipnlfkkvnscvyvmpdflspgaqslirrmi
    vadpmqritiqeirrdpwfnvnlpdylrpmeevqgsyadsrivsklgeamgfsedyivea
    lrsdennevkeaynllhenqviqeklehhh