PDB entry 3h3p

View 3h3p on RCSB PDB site
Description: Crystal structure of HIV epitope-scaffold 4E10 Fv complex
Class: immune system
Keywords: epitope-scaffold Fv complex, IMMUNE SYSTEM
Deposited on 2009-04-16, released 2010-01-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.232
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fv 4E10 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3H3P
    Domains in SCOPe 2.04: d3h3ph_
  • Chain 'I':
    Compound: Fv 4E10 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3H3P
    Domains in SCOPe 2.04: d3h3pi_
  • Chain 'L':
    Compound: Fv 4E10 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3H3P
    Domains in SCOPe 2.04: d3h3pl_
  • Chain 'M':
    Compound: Fv 4E10 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3H3P
    Domains in SCOPe 2.04: d3h3pm_
  • Chain 'S':
    Compound: 4e10_s0_1tjlc_004_n
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3H3P
  • Chain 'T':
    Compound: 4e10_s0_1tjlc_004_n
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3H3P
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3h3pH (H:)
    gsqvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltit
    nyaprfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwg
    qgtlvtvsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3pH (H:)
    qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
    aprfqgrititadrststaylelnslrpedtavyycaregttgwlgkpigafahwgqgtl
    vtvss
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3h3pI (I:)
    gsqvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltit
    nyaprfqgrititadrststaylelnslrpedtavyycaregttgagwlgkpigafahwg
    qgtlvtvsslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3pI (I:)
    qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
    aprfqgrititadrststaylelnslrpedtavyycaregttgwlgkpigafahwgqgtl
    vtvssl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3h3pL (L:)
    maeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsg
    vadrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3pL (L:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3h3pM (M:)
    maeivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsg
    vadrfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3pM (M:)
    eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
    drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklvp
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.