PDB entry 3h3j

View 3h3j on RCSB PDB site
Description: Crystal structure of lactate dehydrogenase mutant (A85R) from staphylococcus aureus complexed with NAD and pyruvate
Class: oxidoreductase
Keywords: Rossmann Fold, alpha-beta motif, Cytoplasm, Glycolysis, NAD, Oxidoreductase, Phosphoprotein, Stress response
Deposited on 2009-04-16, released 2010-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase 1
    Species: Staphylococcus aureus subsp. aureus COL [TaxId:93062]
    Gene: ldh1, SACOL0222
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HJD7
      • engineered (84)
    Domains in SCOPe 2.07: d3h3ja1, d3h3ja2
  • Chain 'B':
    Compound: L-lactate dehydrogenase 1
    Species: Staphylococcus aureus subsp. aureus COL [TaxId:93062]
    Gene: ldh1, SACOL0222
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HJD7 (Start-316)
      • engineered (84)
    Domains in SCOPe 2.07: d3h3jb1, d3h3jb2
  • Heterogens: NAD, PYR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h3jA (A:)
    mnkfkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspt
    tvrvkageysdchdadlvvicagarqkpgetrldlvsknlkifksivgevmaskfdgifl
    vatnpvdilayatwkfsglpkervigsgtildsarfrlllseafdvaprsvdaqiigehg
    dtelpvwshaniagqplktlleqrpegkaqieqifvqtrdaaydiiqakgatyygvamgl
    ariteaifrnedavltvsallegeyeeedvyigvpavinrngirnvveiplndeeqskfa
    hsaktlkdimaeaeelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3jA (A:)
    fkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspttvr
    vkageysdchdadlvvicagarqkpgetrldlvsknlkifksivgevmaskfdgiflvat
    npvdilayatwkfsglpkervigsgtildsarfrlllseafdvaprsvdaqiigehgdte
    lpvwshaniagqplktlleqrpegkaqieqifvqtrdaaydiiqakgatyygvamglari
    teaifrnedavltvsallegeyeeedvyigvpavinrngirnvveiplndeeqskfahsa
    ktlkdimaeaeel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h3jB (B:)
    mnkfkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspt
    tvrvkageysdchdadlvvicagarqkpgetrldlvsknlkifksivgevmaskfdgifl
    vatnpvdilayatwkfsglpkervigsgtildsarfrlllseafdvaprsvdaqiigehg
    dtelpvwshaniagqplktlleqrpegkaqieqifvqtrdaaydiiqakgatyygvamgl
    ariteaifrnedavltvsallegeyeeedvyigvpavinrngirnvveiplndeeqskfa
    hsaktlkdimaeaeelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3jB (B:)
    fkgnkvvligngavgssyafslvnqsivdelviidldtekvrgdvmdlkhatpyspttvr
    vkageysdchdadlvvicagarqkpgetrldlvsknlkifksivgevmaskfdgiflvat
    npvdilayatwkfsglpkervigsgtildsarfrlllseafdvaprsvdaqiigehgdte
    lpvwshaniagqplktlleqrpegkaqieqifvqtrdaaydiiqakgatyygvamglari
    teaifrnedavltvsallegeyeeedvyigvpavinrngirnvveiplndeeqskfahsa
    ktlkdimaeaeelk