PDB entry 3h3c

View 3h3c on RCSB PDB site
Description: Crystal structure of PYK2 in complex with Sulfoximine-substituted trifluoromethylpyrimidine analog
Class: transferase
Keywords: PYK2, Kinase, Alternative splicing, ATP-binding, Cell membrane, Cytoplasm, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Transferase, Tyrosine-protein kinase
Deposited on 2009-04-16, released 2009-05-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein tyrosine kinase 2 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2B, FAK2, PYK2, RAFTK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3h3ca_
  • Heterogens: SO4, P1E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h3cA (A:)
    pqygiaredvvlnrilgegffgevyegvytnhkgekinvavktckkdctldnkekfmsea
    vimknldhphivkligiieeeptwiimelypygelghylernknslkvltlvlyslqick
    amaylesincvhrdiavrnilvaspecvklgdfglsryiededyykasvtrlpikwmspe
    sinfrrfttasdvwmfavcmweilsfgkqpffwlenkdvigvlekgdrlpkpdlcppvly
    tlmtrcwdydpsdrprftelvcslsdvyqmekdiame
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3cA (A:)
    pqygiaredvvlnrilgegffgevyegvytnhkgekinvavktckkdctldnkekfmsea
    vimknldhphivkligiieeeptwiimelypygelghylernknslkvltlvlyslqick
    amaylesincvhrdiavrnilvaspecvklgdfgltrlpikwmspesinfrrfttasdvw
    mfavcmweilsfgkqpffwlenkdvigvlekgdrlpkpdlcppvlytlmtrcwdydpsdr
    prftelvcslsdvyqmekdiame