PDB entry 3h31

View 3h31 on RCSB PDB site
Description: Structure of Rhodothermus marinus HiPIP at 1.0 A resolution
Class: electron transport
Keywords: Iron-sulfur protein, ELECTRON TRANSPORT, Iron, Metal-binding, Transport
Deposited on 2009-04-15, released 2009-12-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.104
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: High potential iron-sulfur protein
  Species: RHODOTHERMUS MARINUS [TaxId:29549]
  Gene: hip
  Database cross-references and differences (RAF-indexed):
  • Uniprot C4P582 (0-73)
  Domains in SCOPe 2.01: d3h31a_
• Heterogens: SF4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3h31A (A:)
  aeltctdvsgltaeeiqmreslqytdhspypdktcancqlyvpaespdqcggcqlikgpi
  hpngyctswvqkat