PDB entry 3h2x

View 3h2x on RCSB PDB site
Description: Crystal Structure of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain
Class: hydrolase
Keywords: SH2-like fold, Alternative splicing, Cytoplasm, Hydrolase, Polymorphism, Protein phosphatase, Systemic lupus erythematosus
Deposited on 2009-04-14, released 2009-06-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.176
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 22
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN22, PTPN8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3h2xa_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3h2xA (A:)
    mdqreilqkfldeaqskkitkeefaneflklkrqstkykadktypttvaekpknikknry
    kdilpydysrvelslitsdedssyinanfikgvygpkayiatqgplsttlldfwrmiwey
    svliivmacmeyemgkkkcerywaepgemqlefgpfsvsceaekrksdyiirtlkvkfns
    etrtiyqfhyknwpdhdvpssidpileliwdvrcyqeddsvpicihcsagcgrtgvicai
    dytwmllkdgiipenfsvfsliremrtqrpslvqtqeqyelvynavlelfkrqmdvirdk
    hs