PDB entry 3h2v

View 3h2v on RCSB PDB site
Description: Human raver1 RRM1 domain in complex with human vinculin tail domain Vt
Class: cell adhesion
Keywords: focal adhesion, actin cytoskeleton, RNP motif, RNA binding, Alternative splicing, Cytoplasm, Nucleus, Phosphoprotein, RNA-binding, CELL ADHESION
Deposited on 2009-04-14, released 2009-07-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.213
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vinculin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: vinculin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: vinculin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: vinculin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Raver-1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAVER1, KIAA1978
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IY67 (2-73)
      • cloning artifact (0-1)
    Domains in SCOPe 2.01: d3h2ve_
  • Chain 'F':
    Compound: Raver-1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAVER1, KIAA1978
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IY67 (2-73)
      • cloning artifact (1)
    Domains in SCOPe 2.01: d3h2vf_
  • Chain 'G':
    Compound: Raver-1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAVER1, KIAA1978
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IY67 (2-73)
      • cloning artifact (0-1)
    Domains in SCOPe 2.01: d3h2vg_
  • Chain 'H':
    Compound: Raver-1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAVER1, KIAA1978
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IY67 (2-73)
      • cloning artifact (1)
    Domains in SCOPe 2.01: d3h2vh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3h2vE (E:)
hmrkilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaainafhqs
rlrerelsvqlqpt

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >3h2vF (F:)
hmrkilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaainafhqs
rlrerelsvqlqpt

    Sequence, based on observed residues (ATOM records): (download) 
    >3h2vF (F:)
mrkilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaainafhqsr
lrerelsvqlqpt

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3h2vG (G:)
hmrkilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaainafhqs
rlrerelsvqlqpt

  • Chain 'H':
    Sequence, based on SEQRES records: (download) 
    >3h2vH (H:)
hmrkilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaainafhqs
rlrerelsvqlqpt

    Sequence, based on observed residues (ATOM records): (download) 
    >3h2vH (H:)
mrkilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaainafhqsr
lrerelsvqlqpt