PDB entry 3h2u

View 3h2u on RCSB PDB site
Description: Human raver1 RRM1, RRM2, and RRM3 domains in complex with human vinculin tail domain Vt
Class: cell adhesion
Keywords: focal adhesion, actin cytoskeleton, RNP motif, RNA binding, Alternative splicing, Cytoplasm, Nucleus, Phosphoprotein, RNA-binding, CELL ADHESION
Deposited on 2009-04-14, released 2009-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.227
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vinculin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h2ua_
  • Chain 'B':
    Compound: Raver-1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAVER1, KIAA1978
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: vinculin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h2uc_
  • Chain 'D':
    Compound: Raver-1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAVER1, KIAA1978
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h2uA (A:)
    eekdeefpeqkagevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvr
    ggsgtkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkil
    stvkatmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrw
    vrktpwyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h2uA (A:)
    deefpeqkagevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrggs
    gtkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstv
    katmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrk
    tp
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h2uC (C:)
    eekdeefpeqkagevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvr
    ggsgtkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkil
    stvkatmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrw
    vrktpwyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h2uC (C:)
    eefpeqevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrggsgtkr
    aliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatm
    lgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirftlrwvrktp
    

  • Chain 'D':
    No sequence available.