PDB entry 3h2f

View 3h2f on RCSB PDB site
Description: Structural Studies of Pterin-Based Inhibitors of Dihydropteroate Synthase
Class: Transferase/Transferase Inhibitor
Keywords: ANTHRACIS, FOLATE BIOSYNTHESIS, DIHYDROPTEROATE, PTERINE, Transferase, Transferase-Transferase Inhibitor COMPLEX
Deposited on 2009-04-14, released 2009-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis str. A2012 [TaxId:191218]
    Gene: folP, BAO_0074
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3h2fa_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis str. A2012 [TaxId:191218]
    Gene: folP, BAO_0074
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3h2fb_
  • Heterogens: B60, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h2fA (A:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h2fA (A:)
    mkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahii
    diggefakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwga
    kaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildp
    gigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclg
    iekgcefvrvhdvkemsrmakmmdamigk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h2fB (B:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h2fB (B:)
    kwdydlrcgeytlnlnektlimgilnvtsfsdggsynevdaavrhakemrdegahiidig
    gevsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepki
    aevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfak
    tpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgce
    fvrvhdvkemsrmakmmdamigk