PDB entry 3h1f

View 3h1f on RCSB PDB site
Description: Crystal structure of CheY mutant D53A of Helicobacter pylori
Class: signaling protein
Keywords: chemotaxis, sulfate-bound cheY, Cytoplasm, Flagellar rotation, Magnesium, Metal-binding, Phosphoprotein, Two-component regulatory system, SIGNALING PROTEIN
Deposited on 2009-04-12, released 2010-03-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY homolog
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: CheY1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71403 (5-End)
      • engineered (57)
    Domains in SCOPe 2.02: d3h1fa_
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3h1fA (A:)
gplgsmkllvvddsstmrriikntlsrlgyedvleaehgveawekldanadtkvlitawn
mpemngldlvkkvrsdsrfkeipiimitteggkaevitalkagvnnyivkpftpqvlkek
levvlgtnd

    Sequence, based on observed residues (ATOM records): (download) 
    >3h1fA (A:)
mkllvvddsstmrriikntlsrlgyedvleaehgveawekldanadtkvlitawnmpemn
gldlvkkvrsdsrfkeipiimitteggkaevitalkagvnnyivkpftpqvlkeklevvl
gtn