PDB entry 3h14

View 3h14 on RCSB PDB site
Description: Crystal structure of a putative aminotransferase from Silicibacter pomeroyi
Class: transferase
Keywords: Aminotransferase, Silicibacter pomeroyi, YP_167802.1, SPO2589, STRUCTURAL GENOMICS, PSI-2, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, Pyridoxal phosphate, Transferase, New York SGX Research Center for Structural Genomics
Deposited on 2009-04-10, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminotransferase, classes I and II
    Species: Silicibacter pomeroyi DSS-3 [TaxId:246200]
    Gene: SPO2589, YP_167802.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LQA4 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3h14a1, d3h14a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h14A (A:)
    mslknssrsavdpfivmdvmeaarraeeagrriihmevgqpgtgaprgavealaksletd
    algytvalglpalrqriarlygewygvdldpgrvvitpgssggfllaftalfdsgdrvgi
    gapgypsyrqilralglvpvdlptapenrlqpvpadfagldlaglmvaspanptgtmldh
    aamgalieaaqaqgasfisdeiyhgieyeakavtaleltdecyvinsfskyfsmtgwrvg
    wmvvpedqvrvveriaqnmficaphasqvaalaaldcdaelqanldvykanrklmlerlp
    kagftriappdgafyvyadvsdltddsrafaaeilekagvavtpgldfdpergagtlrfs
    yaratadieegldrleafmqargeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h14A (A:)
    lknssrsavdpfivmdvmeaarraeeagrriihmevgqpgtgaprgavealaksleglpa
    lrqriarlygewygvdldpgrvvitpgssggfllaftalfdsgdrvgigapgypsyrqil
    ralglvpvdlptapenrlqpvpadfagldlaglmvaspanptgtmldhaamgalieaaqa
    qgasfisdeiyhgieyeakavtaleltdecyvinsfskyfsmtgwrvgwmvvpedqvrvv
    eriaqnmficaphasqvaalaaldcdaelqanldvykanrklmlerlpkagftriappdg
    afyvyadvsdltddsrafaaeilekagvavtpgldfdpergagtlrfsyaratadieegl
    drleafmqar