PDB entry 3h11

View 3h11 on RCSB PDB site
Description: Zymogen caspase-8:c-FLIPL protease domain complex
Class: apoptosis
Keywords: cell death, apoptosis, Caspase, Alternative splicing, Host-virus interaction, Polymorphism, Cytoplasm, Disease mutation, Hydrolase, Phosphoprotein, Protease, Thiol protease, Zymogen
Deposited on 2009-04-10, released 2009-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-24, with a file datestamp of 2009-11-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CASP8 and FADD-like apoptosis regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: CFLAR, CASH, CASP8AP1, CLARP, MRIT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h11a_
  • Chain 'B':
    Compound: caspase-8
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP8, MCH5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h11b_
  • Chain 'C':
    Compound: IETD aldehyde inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 3H11 (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h11A (A:)
    keqrlkeqlgaqqepvkksiqeseaflpqsipeerykmkskplgicliidcignetellr
    dtftslgyevqkflhlsmhgisqilgqfacmpehrdydsfvcvlvsrggsqsvygvdqth
    sglplhhirrmfmgdscpylagkpkmffiqnyvvsegqlenssllevdgpamknvefkaq
    krglctvhreadffwslctadmslleqshsspslylqclsqklrqerkrplldlhielng
    ymydwnsrvsakekyyvwlqhtlrkklilsyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h11A (A:)
    qsipeerykmkskplgicliidcignetellrdtftslgyevqkflhlsmhgisqilgqf
    acmpehrdydsfvcvlvsrggsqsvygvdqthsglplhhirrmfmgdscpylagkpkmff
    iqnyvvvhreadffwslctadmslleqshsspslylqclsqklrqerkrplldlhielng
    ymydwnsrvsakekyyvwlqhtlrkklilsyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h11B (B:)
    sesqtldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfee
    lhfeikphddctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyel
    tsqftglkcpslagkpkvffiqacqgdnyqkgipvetaseeqpylemalsspqtryipde
    adfllgmatvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnyevsnkddk
    knmgkqmpqptftlrkklvfpsdvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h11B (B:)
    dkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfeik
    phddctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqftg
    lkcpslagkpkvffiqacqgdnyqqtryipdeadfllgmatvnncvsyrnpaegtwyiqs
    lcqslrercprgddiltiltevnyevsnkgkqmpqptftlrkklvfpsd
    

  • Chain 'C':
    No sequence available.