PDB entry 3h0j

View 3h0j on RCSB PDB site
Description: Crystal structure of the carboxyltransferase domain of acetyl-coenzyme A carboxylase in complex with compound 2
Class: transferase
Keywords: TRANSFERASE, ACETYL-COA CARBOXYLASE, CARBOXYLTRANSFERASE, INHIBITOR, ACC, CT, ATP-binding, Biotin, Cytoplasm, Fatty acid biosynthesis, Ligase, Lipid synthesis, Metal-binding, Multifunctional enzyme, Nucleotide-binding
Deposited on 2009-04-09, released 2010-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.228
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FAS3, ACC1, YNR016C, N3175
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h0ja1, d3h0ja2
  • Chain 'B':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FAS3, ACC1, YNR016C, N3175
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h0jb1, d3h0jb2
  • Chain 'C':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FAS3, ACC1, YNR016C, N3175
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h0jc1, d3h0jc2
  • Heterogens: B36

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h0jA (A:)
    masgsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkl
    tddffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfk
    igsfgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkg
    fqylyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsglia
    gatsrayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevyt
    snlqlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvd
    ftptndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvi
    gvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilan
    wrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqm
    emyadvnaragvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqis
    kqladrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlne
    eylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglkle
    sfaqdlakkirsdhdnaidglsevikmlstddkekllktlklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h0jA (A:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskele
    wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
    ieenyktlddklkglklesfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h0jB (B:)
    masgsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkl
    tddffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfk
    igsfgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkg
    fqylyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsglia
    gatsrayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevyt
    snlqlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvd
    ftptndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvi
    gvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilan
    wrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqm
    emyadvnaragvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqis
    kqladrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlne
    eylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglkle
    sfaqdlakkirsdhdnaidglsevikmlstddkekllktlklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h0jB (B:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskele
    wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
    ieenyktlddklkgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h0jC (C:)
    masgsmhlrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkl
    tddffisneliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfk
    igsfgpqedeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkg
    fqylyltsegmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsglia
    gatsrayhdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevyt
    snlqlggtqimynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvd
    ftptndetydvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvi
    gvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilan
    wrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqm
    emyadvnaragvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqis
    kqladrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlne
    eylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglkle
    sfaqdlakkirsdhdnaidglsevikmlstddkekllktlklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h0jC (C:)
    wlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengelt
    everepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteya
    rkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdk
    ensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcr
    svgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshl
    tavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmiegre
    tesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpanpn
    saetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevlkyg
    sfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepqgmv
    gikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskelewtearrfffw
    rlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktldd
    klkgl