PDB entry 3h0f

View 3h0f on RCSB PDB site
Description: Crystal structure of the human Fyn SH3 R96W mutant
Class: transferase
Keywords: beta barrel, TRANSFERASE
Deposited on 2009-04-09, released 2010-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Fyn
    Species: Homo sapiens [TaxId:9606]
    Gene: FYN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06241 (Start-72)
      • engineered (26)
    Domains in SCOPe 2.08: d3h0fa_
  • Heterogens: PG5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3h0fA (A:)
gsmtgtlrtrggtgvtlfvalydyeawteddlsfhkgekfqilnssegdwwearslttge
tgyipsnyvapvd

    Sequence, based on observed residues (ATOM records): (download) 
    >3h0fA (A:)
vtlfvalydyeawteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapvd