PDB entry 3h0a

View 3h0a on RCSB PDB site
Description: Crystal Structure of Peroxisome Proliferator-Activated Receptor Gamma (PPARg) and Retinoic Acid Receptor Alpha (RXRa) in Complex with 9-cis Retinoic Acid, Co-activator Peptide, and a Partial Agonist
Class: transcription
Keywords: PPAR, transcription, nuclear receptor fold, transcription regulation, hormone, growth factor receptor, complex, DNA-binding, Host-virus interaction, Isopeptide bond, Metal-binding, Nucleus, Receptor, Zinc-finger, Activator, Diabetes mellitus, Disease mutation, Obesity, Phosphoprotein, Acyltransferase, Proto-oncogene, Transferase
Deposited on 2009-04-08, released 2009-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.251
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h0aa_
  • Chain 'B':
    Compound: Nuclear receptor coactivator 1, Co-activator Peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h0ad_
  • Chain 'E':
    Compound: Nuclear receptor coactivator 1, Co-activator Peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 9RA, D30, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h0aA (A:)
    edmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakrip
    hfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifd
    rvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhk
    ypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmeml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h0aA (A:)
    edmpverileaelavendpvtnicqaadkqlftlvewakriphfselplddqvillragw
    nelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdkt
    elgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpal
    rsiglkclehlfffkligdtpidtflmeml
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3h0aD (D:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
    hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
    iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
    ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
    vtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h0aD (D:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikqe
    qskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlas
    lmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiavii
    lsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvql
    lqvikktetdmslhpllqeiykdly
    

  • Chain 'E':
    No sequence available.