PDB entry 3h01

View 3h01 on RCSB PDB site
Description: structure of the c-terminal domain of a putative hiv-1 gp41 fusion intermediate
Deposited on 2009-04-08, released 2009-12-15
The last revision was dated 2021-10-13, with a file datestamp of 2021-10-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.206
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: envelope glycoprotein gp160
  Species: Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834]
  Gene: ENV
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q70626 (0-53)
    • engineered mutation (26)
• Chain 'B':
  Compound: envelope glycoprotein gp160
  Species: Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834]
  Gene: ENV
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q70626 (0-53)
    • engineered mutation (26)
• Heterogens: HEZ, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >3h01A (A:)
  ewdreinnytslihslieesqnqqekleqelleldkwaslwnwfnitnwlwyik
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records:
  

  >3h01B (B:)
  ewdreinnytslihslieesqnqqekleqelleldkwaslwnwfnitnwlwyik
  

  
  Sequence, based on observed residues (ATOM records):
  

  >3h01B (B:)
  ytslihslieesqnqqekleqelleldkwaslwnwfnitnwlwyik