PDB entry 3gzx

View 3gzx on RCSB PDB site
Description: Crystal Structure of the Biphenyl Dioxygenase in complex with Biphenyl from Comamonas testosteroni Sp. Strain B-356
Class: oxidoreductase
Keywords: DIOXYGENASE, RIESKIE, NON-HEME IRON, 2Fe-2S, Aromatic hydrocarbons catabolism, Iron, Iron-sulfur, Metal-binding, NAD, Oxidoreductase
Deposited on 2009-04-08, released 2010-05-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.207
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Comamonas testosteroni [TaxId:285]
    Gene: bphA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Comamonas testosteroni [TaxId:285]
    Gene: bphE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3gzxb_
  • Heterogens: FE2, FES, BNL, GOL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3gzxB (B:)
mistplskefewpakpvslelqhqveqfyyreaqlldhhafqawfallaedihywmpirt
vrtareqgleyvpaganahfddthatmygrirqktsdlnwaedppsrtrhlvsnvivrem
dtpgtlevasafllyrsrlerqvdvfagerrdvlriadnplgfqiakrtiildqstvlan
nlsvff