PDB entry 3gzm

View 3gzm on RCSB PDB site
Description: Crystal Structure of holo PfACP Reduced Monomer
Class: biosynthetic protein
Keywords: helix bundle, phosphopantetheine, fatty acid biosynthesis, Lipid synthesis, Transit peptide, BIOSYNTHETIC PROTEIN
Deposited on 2009-04-07, released 2009-04-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.209
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: ACP, acpP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3gzma_
  • Chain 'B':
    Compound: Acyl carrier protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: ACP, acpP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3gzmb_
  • Heterogens: PNS, BME, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3gzmA (A:)
sslkstfddikkiiskqlsveedkiqmnsnftkdlgadsldlvelimaleekfnvtisdq
dalkintvqdaidyieknnkq

    Sequence, based on observed residues (ATOM records): (download) 
    >3gzmA (A:)
slkstfddikkiiskqlsveedkiqmnsnftkdlgadsldlvelimaleekfnvtisdqd
alkintvqdaidyieknn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3gzmB (B:)
sslkstfddikkiiskqlsveedkiqmnsnftkdlgadsldlvelimaleekfnvtisdq
dalkintvqdaidyieknnkq