PDB entry 3gyh
View 3gyh on RCSB PDB site
Description: Crystal Structure Analysis of S. Pombe ATL in complex with damaged DNA containing POB
Deposited on
2009-04-03, released
2009-06-16
The last revision was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.243
AEROSPACI score: 0.18
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'X':
Compound: Alkyltransferase-like protein 1
Species: Schizosaccharomyces pombe [TaxId:4896]
Gene: atl1, SPAC1250.04c
Database cross-references and differences (RAF-indexed):
- Chain 'Y':
Compound: DNA (5'-d(*gp*cp*cp*ap*tp*gp*gp*cp*tp*ap*gp*tp*a)-3')
- Chain 'Z':
Compound: DNA (5'-d(*cp*tp*ap*cp*tp*ap*gp*cp*cp*ap*tp*gp*g)-3')
- Heterogens: PBO, HOH
PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.
- Chain 'X':
Sequence, based on SEQRES records:
>3gyhX (X:)
mrmdefytkvydavceipygkvstygeiaryvgmpsyarqvgqamkhlhpethvpwhrvi
nsrgtiskrdisageqrqkdrleeegveiyqtslgeyklnlpeymwkpgshhhhhh
Sequence, based on observed residues (ATOM records):
>3gyhX (X:)
mrmdefytkvydavceipygkvstygeiaryvgmpsyarqvgqamkhlhpethvpwhrvi
nsrgtiskrdisageqrqkdrleeegveiyqtslgeyklnlpeymwkp
- Chain 'Y':
No sequence available.
- Chain 'Z':
No sequence available.