PDB entry 3gyh

View 3gyh on RCSB PDB site
Description: Crystal Structure Analysis of S. Pombe ATL in complex with damaged DNA containing POB
Deposited on 2009-04-03, released 2009-06-16
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.243
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Alkyltransferase-like protein 1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: atl1, SPAC1250.04c
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: DNA (5'-d(*gp*cp*cp*ap*tp*gp*gp*cp*tp*ap*gp*tp*a)-3')
  • Chain 'Z':
    Compound: DNA (5'-d(*cp*tp*ap*cp*tp*ap*gp*cp*cp*ap*tp*gp*g)-3')
  • Heterogens: PBO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'X':
    Sequence, based on SEQRES records:
    >3gyhX (X:)
    mrmdefytkvydavceipygkvstygeiaryvgmpsyarqvgqamkhlhpethvpwhrvi
    nsrgtiskrdisageqrqkdrleeegveiyqtslgeyklnlpeymwkpgshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3gyhX (X:)
    mrmdefytkvydavceipygkvstygeiaryvgmpsyarqvgqamkhlhpethvpwhrvi
    nsrgtiskrdisageqrqkdrleeegveiyqtslgeyklnlpeymwkp
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.