PDB entry 3gy8

View 3gy8 on RCSB PDB site
Description: A comparative study on the inhibition of bovine beta-trypsin by bis-benzamidines diminazene and pentamidine by X-ray crystallography and ITC
Class: hydrolase
Keywords: bovine beta-trypsin, berenil, diminazene, protein-ligand complex, protein-ligand interaction, Calcium, Digestion, Disulfide bond, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen
Deposited on 2009-04-03, released 2010-03-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.172
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3gy8a_
  • Heterogens: CA, BRN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3gy8A (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn