PDB entry 3gxu

View 3gxu on RCSB PDB site
Description: Crystal structure of Eph receptor and ephrin complex
Class: transferase
Keywords: Complex structure, Eph, ephrin, ATP-binding, Glycoprotein, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase, Developmental protein, Differentiation, Disulfide bond, Host-virus interaction, Neurogenesis
Deposited on 2009-04-03, released 2009-10-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-11-10, with a file datestamp of 2009-11-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA4, HEK8, SEK, TYRO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3gxua_
  • Chain 'B':
    Compound: ephrin-b2
    Species: Homo sapiens [TaxId:9606]
    Gene: EFNB2, EPLG5, HTKL, LERK5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3gxub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gxuA (A:)
    nevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtdw
    itregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidti
    aadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gxuA (A:)
    nevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtdw
    itregaqrvyieikftlrdcnslpgtcketfnlyyyesdndkerfienqfvkidtiaade
    sftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gxuB (B:)
    sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
    drctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegld
    nqeggvcqtramkilmkvgqdas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gxuB (B:)
    sivlepiywnssnskflpgqglvlypqigdkldiicpkvtvqyeyykvymvdkdqadrct
    ikentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnqegg
    vcqtramkilmkvgqdas