PDB entry 3gxs

View 3gxs on RCSB PDB site
Description: Crystal structure of a domain of phenylacetate-coenzyme A ligase from Bacteroides vulgatus ATCC 8482
Deposited on 2009-04-02, released 2009-04-21
The last revision was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.187
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenylacetate-coenzyme A ligase
    Species: Bacteroides vulgatus ATCC 8482 [TaxId:435590]
    Gene: BVU_1668
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6L0Y5 (3-108)
      • expression tag (0-2)
  • Heterogens: ACT, GOL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3gxsA (A:)
snaddmiilkgvnifpiqietillqfkelgsdylitletaesndemtvevelsqlftddy
grlqaltreitrqlkdeilvtprvklvpkgalpksegkavrvkdlrktf

    Sequence, based on observed residues (ATOM records):
    >3gxsA (A:)
snaddmiilkgvnifpiqietillqfkelgsdylitletaesndemtvevelsqlftddy
grlqaltreitrqlkdeilvtprvklvpkgalpksavrvkdlrktf